Ensembl ID ENSG00000184898 Gene ID 375287 Accession 24790
Gene Symbol RBM43 Alias C2orf38 Full Name RNA binding motif protein 43
Position 2 : 151247940 - 151261863 Length 13924 bases Strand Minus strand
Status Confidence Main interacting RNAsmRNARBP type Non-canonical_RBPs
Summary Predicted to enable RNA binding activity. [provided by Alliance of Genome Resources, Apr 2022]

ENSG00000184898 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM051015202530
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM