Ensembl ID ENSG00000179151 Gene ID 80153 Accession 26114
Gene Symbol EDC3 Alias YJDC;LSM16;MRT50;YJEFN2;hYjeF_N2-15q23 Full Name enhancer of mRNA decapping 3
Position 15 : 74630558 - 74696292 Length 65735 bases Strand Minus strand
Status Confidence Main interacting RNAsmRNARBP type Canonical_RBPs
Summary This gene encodes a protein that is important in mRNA degradation. The encoded protein is a component of a decapping complex that promotes efficient removal of the monomethylguanosine (m7G) cap from mRNAs, as part of the 5' to 3' mRNA decay pathway. Mutations in this gene have been identified in human patients with an autosomal recessive form of intellectual disability. [provided by RefSeq, May 2017]

ENSG00000179151 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM051015202530354045
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM