Ensembl ID ENSG00000174720 Gene ID 51574 Accession 24912
Gene Symbol LARP7 Alias ALAZS;PIP7S;hLARP7;HDCMA18P Full Name La ribonucleoprotein 7, transcriptional regulator
Position 4 : 112637107 - 112657695 Length 20589 bases Strand Plus strand
Status Confidence Main interacting RNAsncRNARBP type Canonical_RBPs
Summary This gene encodes a protein which is found in the 7SK snRNP (small nuclear ribonucleoprotein). This snRNP complex inhibits a cyclin-dependent kinase, positive transcription elongation factor b, which is required for paused RNA polymerase II at a promoter to begin transcription elongation. A pseudogene of this gene is located on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2012]

ENSG00000174720 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM01020304050
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM