Ensembl ID ENSG00000169594 Gene ID 646 Accession 1081
Gene Symbol BNC1 Alias BNC;bn1;BSN1;POF16;HsT19447 Full Name basonuclin zinc finger protein 1
Position 15 : 83255884 - 83284664 Length 28781 bases Strand Minus strand
Status Confidence Main interacting RNAsN.A.RBP type Canonical_RBPs
Summary This gene encodes a zinc finger protein present in the basal cell layer of the epidermis and in hair follicles. It is also found in abundance in the germ cells of testis and ovary. This protein is thought to play a regulatory role in keratinocyte proliferation and it may also be a regulator for rRNA transcription. Disruption of this gene has been implicated in premature ovarian failure as well as testicular premature aging. [provided by RefSeq, Sep 2020]

ENSG00000169594 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM020406080100120140160
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM