Ensembl ID ENSG00000167962 Gene ID 90850 Accession 28079
Gene Symbol ZNF598 Alias HEL2 Full Name zinc finger protein 598, E3 ubiquitin ligase
Position 16 : 1997655 - 2009821 Length 12167 bases Strand Minus strand
Status Confidence Main interacting RNAsmRNARBP type Non-canonical_RBPs
Summary Zinc-finger proteins bind nucleic acids and play important roles in various cellular functions, including cell proliferation, differentiation, and apoptosis. This protein and Grb10-interacting GYF protein 2 have been identified as a components of the mammalian 4EHP (m4EHP) complex. The complex is thought to function as a translation repressor in embryonic development. [provided by RefSeq, Oct 2012]

ENSG00000167962 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM010203040506070
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM