Ensembl ID ENSG00000164934 Gene ID 25879 Accession 24535
Gene Symbol DCAF13 Alias GM83;Sof1;WDSOF1;HSPC064 Full Name DDB1 and CUL4 associated factor 13
Position 8 : 103414714 - 103443453 Length 28740 bases Strand Plus strand
Status Confidence Main interacting RNAsrRNARBP type Canonical_RBPs
Summary Enables estrogen receptor binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Located in several cellular components, including centrosome; cytosol; and nuclear lumen. Part of Cul4-RING E3 ubiquitin ligase complex. [provided by Alliance of Genome Resources, Apr 2022]

ENSG00000164934 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM01020304050
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM
HNSCCOADBRCAREADLUSCPRADGBMLIHCSTADUCECLUAD01020304050
tumornormal