Ensembl ID ENSG00000163811 Gene ID 23160 Accession 28945
Gene Symbol WDR43 Alias UTP5;NET12 Full Name WD repeat domain 43
Position 2 : 28894667 - 28948219 Length 53553 bases Strand Plus strand
Status Confidence Main interacting RNAsrRNARBP type Canonical_RBPs
Summary Enables RNA binding activity. Involved in positive regulation of rRNA processing and positive regulation of transcription by RNA polymerase I. Located in fibrillar center. [provided by Alliance of Genome Resources, Apr 2022]

ENSG00000163811 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM010203040506070
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM