Ensembl ID ENSG00000163694 Gene ID 54502 Accession 30358
Gene Symbol RBM47 Alias NET18 Full Name RNA binding motif protein 47
Position 4 : 40423267 - 40630875 Length 207609 bases Strand Minus strand
Status Confidence Main interacting RNAsmRNARBP type Canonical_RBPs
Summary Enables RNA binding activity. Predicted to act upstream of or within cytidine to uridine editing and hematopoietic progenitor cell differentiation. Predicted to be active in nucleus. [provided by Alliance of Genome Resources, Apr 2022]

ENSG00000163694 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM0102030405060708090
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM