Ensembl ID ENSG00000148688 Gene ID 10556 Accession 17688
Gene Symbol RPP30 Alias TSG15 Full Name ribonuclease P/MRP subunit p30
Position 10 : 90871952 - 90903262 Length 31311 bases Strand Plus strand
Status Confidence Main interacting RNAsncRNARBP type Canonical_RBPs
Summary Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Part of multimeric ribonuclease P complex and ribonuclease MRP complex. [provided by Alliance of Genome Resources, Apr 2022]

ENSG00000148688 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM05101520253035
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM