Ensembl ID ENSG00000145331 Gene ID 93587 Accession 28403
Gene Symbol TRMT10A Alias MSSGM;TRM10;MSSGM1;RG9MTD2;HEL-S-88 Full Name tRNA methyltransferase 10A
Position 4 : 99546709 - 99564039 Length 17331 bases Strand Minus strand
Status Confidence Main interacting RNAstRNARBP type Canonical_RBPs
Summary This gene encodes a protein that belongs to the tRNA (Guanine-1)-methyltransferase family. A similar gene in yeast modifies several different tRNA species. Mutations in this gene are associated with microcephaly, short stature, and impaired glucose metabolism. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

ENSG00000145331 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM024681012
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM