Ensembl ID ENSG00000137074 Gene ID 54840 Accession 15984
Gene Symbol APTX Alias AOA;AOA1;AXA1;EAOH;EOAHA;FHA-HIT Full Name aprataxin
Position 9 : 32886601 - 33025130 Length 138530 bases Strand Minus strand
Status Confidence Main interacting RNAsdiverseRBP type Canonical_RBPs
Summary This gene encodes a member of the histidine triad (HIT) superfamily. The encoded protein may play a role in single-stranded DNA repair through its nucleotide-binding activity and its diadenosine polyphosphate hydrolase activity. Mutations in this gene have been associated with ataxia-ocular apraxia. Alternatively spliced transcript variants have been identified for this gene.[provided by RefSeq, Aug 2010]

ENSG00000137074 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM010203040
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM