Ensembl ID ENSG00000126351 Gene ID 7067 Accession 11796
Gene Symbol THRA Alias AR7;EAR7;ERBA;CHNG6;ERBA1;NR1A1;THRA1;THRA2;c-erbA;ERB-T-1;TRalpha;THRalpha;TRalpha1;TRalpha2;c-ERBA-1;THRalpha1;THRalpha2 Full Name thyroid hormone receptor alpha
Position 17 : 40058290 - 40093867 Length 35578 bases Strand Plus strand
Status Confidence Main interacting RNAsN.A.RBP type Non-canonical_RBPs
Summary The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

ENSG00000126351 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM020406080100120140160180
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM