Ensembl ID ENSG00000122965 Gene ID 9904 Accession 29098
Gene Symbol RBM19 Alias Mrd1 Full Name RNA binding motif protein 19
Position 12 : 113816742 - 113966325 Length 149584 bases Strand Minus strand
Status Confidence Main interacting RNAsrRNARBP type Canonical_RBPs
Summary This gene encodes a nucleolar protein that contains six RNA-binding motifs. The encoded protein may be involved in regulating ribosome biogenesis. Multiple alternatively spliced variants, encoding the same protein, have been identified.[provided by RefSeq, Apr 2009]

ENSG00000122965 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM010203040506070
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM