Ensembl ID ENSG00000122687 Gene ID 29960 Accession 16352
Gene Symbol MRM2 Alias FJH1;FTSJ2;HEL97;RRMJ2;MTDPS17 Full Name mitochondrial rRNA methyltransferase 2
Position 7 : 2234195 - 2242205 Length 8011 bases Strand Minus strand
Status Confidence Main interacting RNAsrRNARBP type Canonical_RBPs
Summary The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and it may be involved in the processing and modification of rRNA. This gene has been suggested to be involved in cell cycle control and DNA repair. [provided by RefSeq, Jul 2008]

ENSG00000122687 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM01020304050607080
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM