Ensembl ID ENSG00000121057 Gene ID 8165 Accession 367
Gene Symbol AKAP1 Alias AKAP;PRKA1;AKAP84;TDRD17;AKAP121;AKAP149;D-AKAP1;PPP1R43;SAKAP84 Full Name A-kinase anchoring protein 1
Position 17 : 57085092 - 57121346 Length 36255 bases Strand Plus strand
Status Confidence Main interacting RNAsmRNARBP type Canonical_RBPs
Summary The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. This protein is speculated to be involved in the cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment. [provided by RefSeq, Jul 2008]

ENSG00000121057 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM020406080100120140160180
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM