Ensembl ID ENSG00000108518 Gene ID 5216 Accession 8881
Gene Symbol PFN1 Alias ALS18 Full Name profilin 1
Position 17 : 4945652 - 4949061 Length 3410 bases Strand Minus strand
Status Confidence Main interacting RNAsN.A.RBP type Non-canonical_RBPs
Summary This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. [provided by RefSeq, Jul 2012]

ENSG00000108518 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM0500100015002000
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM