Ensembl ID ENSG00000103342 Gene ID 2935 Accession 4621
Gene Symbol GSPT1 Alias GST1;ETF3A;eRF3a;551G9.2 Full Name G1 to S phase transition 1
Position 16 : 11868128 - 11916082 Length 47955 bases Strand Minus strand
Status Confidence Main interacting RNAsmRNARBP type Canonical_RBPs
Summary Enables translation release factor activity. Involved in regulation of translational termination. Acts upstream of or within protein methylation. Predicted to be located in cytosol. Predicted to be part of translation release factor complex. [provided by Alliance of Genome Resources, Apr 2022]

ENSG00000103342 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM050100150200
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM