Ensembl ID ENSG00000102109 Gene ID 27344 Accession 17301
Gene Symbol PCSK1N Alias PEN;SAAS;SCG8;BigLEN;SgVIII;PROSAAS Full Name proprotein convertase subtilisin/kexin type 1 inhibitor
Position X : 48831096 - 48835610 Length 4515 bases Strand Minus strand
Status Confidence Main interacting RNAsN.A.RBP type Canonical_RBPs
Summary The protein encoded by this gene functions as an inhibitor of prohormone convertase 1, which regulates the proteolytic cleavage of neuroendocrine peptide precursors. The proprotein is further processed into multiple short peptides. A polymorphism within this gene may be associated with obesity. [provided by RefSeq, Aug 2013]

ENSG00000102109 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM0500100015002000250030003500
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM