Ensembl ID ENSG00000080824 Gene ID 3320 Accession 5253
Gene Symbol HSP90AA1 Alias EL52;HSPN;LAP2;HSP86;HSPC1;HSPCA;Hsp89;Hsp90;LAP-2;HSP89A;HSP90A;HSP90N;Hsp103;HSPCAL1;HSPCAL4;HEL-S-65p Full Name heat shock protein 90 alpha family class A member 1
Position 14 : 102080742 - 102139699 Length 58958 bases Strand Minus strand
Status Confidence Main interacting RNAsN.A.RBP type Non-canonical_RBPs
Summary The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

ENSG00000080824 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM0500100015002000
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM