Ensembl ID ENSG00000070814 Gene ID 6949 Accession 11654
Gene Symbol TCOF1 Alias TCS;MFD1;TCS1;treacle Full Name treacle ribosome biogenesis factor 1
Position 5 : 150357629 - 150400308 Length 42680 bases Strand Plus strand
Status Confidence Main interacting RNAsrRNARBP type Non-canonical_RBPs
Summary This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]

ENSG00000070814 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM010203040
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM
KIRCHNSCCOADBRCAKICHLUSCKIRPLIHCSTADCHOLLUAD010203040
tumornormal