Ensembl ID ENSG00000018869 Gene ID 147948 Accession 26421
Gene Symbol ZNF582 Alias NA Full Name zinc finger protein 582
Position 19 : 56375846 - 56393538 Length 17693 bases Strand Minus strand
Status Confidence Main interacting RNAsN.A.RBP type Canonical_RBPs
Summary The protein encoded by this gene is a zing finger protein and putative transcription factor that is highly methylated in cervical cancers. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

ENSG00000018869 Expression In 33 Tumors

ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM012345678
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVMFPKM